SCOP 1.57: Domain d1ar1b2: 1ar1 B:1-107

Lineage for d1ar1b2 (1ar1 B:1-107)

1. Root: SCOP 1.57

2. Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (10 families)

5. Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins)

6. Protein Cytochrome c oxidase [56884] (3 species)

7. Species Paracoccus denitrificans [TaxId:266] [56886] (2 PDB entries)

8. Domain d1ar1b2: 1ar1 B:1-107 [43619]
   Other proteins in same PDB: d1ar1b1, d1ar1c_, d1ar1d_

Details for d1ar1b2

PDB Entry: 1ar1, 2.7 Å

PDB Description: Structure at 2.7 Angstrom Resolution of the Paracoccus Denitrificans two-subunit Cytochrome C Oxidase Complexed with an Antibody Fv Fragment

SCOP Domain Sequences for d1ar1b2:

Sequence; same for both SEQRES and ATOM records:

>d1ar1b2 f.2.1.3 (B:1-107) Cytochrome c oxidase {Paracoccus denitrificans}
qdvlgdlpvigkpvnggmnfqpassplahdqqwldhfvlyiitavtifvcllllicivrf
nrranpvparfthntpieviwtlvpvlilvaigafslpilfrsqemp

Timeline for d1ar1b2:

• d1ar1b2 first appeared (with stable ids) in SCOP 1.55
  
• d1ar1b2 appears in SCOP 1.59
  
• d1ar1b2 appears in the current release, SCOPe 2.08