Lineage for d1ocox_ (1oco X:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237971Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1238177Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
  5. 1238178Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)
  6. 1238179Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 1238180Species Cow (Bos taurus) [TaxId:9913] [81420] (7 PDB entries)
  8. 1238194Domain d1ocox_: 1oco X: [43615]
    Other proteins in same PDB: d1ocoa_, d1ocob1, d1ocob2, d1ococ_, d1ocod_, d1ocoe_, d1ocof_, d1ocog_, d1ocoh_, d1ocoi_, d1ocoj_, d1ocol_, d1ocom_, d1ocon_, d1ocoo1, d1ocoo2, d1ocop_, d1ocoq_, d1ocor_, d1ocos_, d1ocot_, d1ocou_, d1ocov_, d1ocow_, d1ocoy_, d1ocoz_
    complexed with cmo, cu, hea, mg, na, zn

Details for d1ocox_

PDB Entry: 1oco (more details), 2.8 Å

PDB Description: bovine heart cytochrome c oxidase in carbon monoxide-bound state
PDB Compounds: (X:) cytochrome c oxidase

SCOPe Domain Sequences for d1ocox_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocox_ f.23.5.1 (X:) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOPe Domain Coordinates for d1ocox_:

Click to download the PDB-style file with coordinates for d1ocox_.
(The format of our PDB-style files is described here.)

Timeline for d1ocox_: