SCOP 1.69: Domain d1ocov_: 1oco V:

Lineage for d1ocov_ (1oco V:)

1. Root: SCOP 1.69

2. Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family)

5. Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81412] (7 PDB entries)

8. Domain d1ocov_: 1oco V: [43613]
   Other proteins in same PDB: d1ocoa_, d1ocob1, d1ocob2, d1ococ_, d1ocod_, d1ocoe_, d1ocof_, d1ocog_, d1ocoh_, d1ocoj_, d1ocok_, d1ocol_, d1ocom_, d1ocon_, d1ocoo1, d1ocoo2, d1ocop_, d1ocoq_, d1ocor_, d1ocos_, d1ocot_, d1ocou_, d1ocow_, d1ocox_, d1ocoy_, d1ocoz_

Details for d1ocov_

PDB Entry: 1oco, 2.8 Å

PDB Description: bovine heart cytochrome c oxidase in carbon monoxide-bound state

SCOP Domain Sequences for d1ocov_:

Sequence; same for both SEQRES and ATOM records:

>d1ocov_ f.23.3.1 (V:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus)}
stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
eemrkagifqsak

Timeline for d1ocov_:

• d1ocov_ first appeared (with stable ids) in SCOP 1.55, called d1ocov1
  
• d1ocov_ appears in SCOP 1.67
  
• d1ocov_ appears in SCOP 1.71
  
• d1ocov_ appears in the current release, SCOPe 2.08