Class f: Membrane and cell surface proteins and peptides [56835] (49 folds) |
Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) |
Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (1 protein) |
Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species) probably responsible for the dimerization of the mitochondrial cytochrome c oxidase |
Species Cow (Bos taurus) [TaxId:9913] [81408] (7 PDB entries) |
Domain d1ocot_: 1oco T: [43612] Other proteins in same PDB: d1ocoa_, d1ocob1, d1ocob2, d1ococ_, d1ocod_, d1ocoe_, d1ocof_, d1ocoh_, d1ocoi_, d1ocoj_, d1ocok_, d1ocol_, d1ocom_, d1ocon_, d1ocoo1, d1ocoo2, d1ocop_, d1ocoq_, d1ocor_, d1ocos_, d1ocou_, d1ocov_, d1ocow_, d1ocox_, d1ocoy_, d1ocoz_ complexed with cmo, cu, hea, mg, na, zn |
PDB Entry: 1oco (more details), 2.8 Å
SCOP Domain Sequences for d1ocot_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ocot_ f.23.2.1 (T:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus)} asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf swgdgnhtffhnprvnplptgyek
Timeline for d1ocot_:
View in 3D Domains from other chains: (mouse over for more information) d1ocoa_, d1ocob1, d1ocob2, d1ococ_, d1ocod_, d1ocoe_, d1ocof_, d1ocog_, d1ocoh_, d1ocoi_, d1ocoj_, d1ocok_, d1ocol_, d1ocom_, d1ocon_, d1ocoo1, d1ocoo2, d1ocop_, d1ocoq_, d1ocor_, d1ocos_, d1ocou_, d1ocov_, d1ocow_, d1ocox_, d1ocoy_, d1ocoz_ |