SCOPe 2.06: Domain d1ocoq_: 1oco Q:

Lineage for d1ocoq_ (1oco Q:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family)
   automatically mapped to Pfam PF02936

5. Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81403] (19 PDB entries)

8. Domain d1ocoq_: 1oco Q: [43611]
   Other proteins in same PDB: d1ocoa_, d1ocob1, d1ocob2, d1ococ_, d1ocoe_, d1ocof_, d1ocog_, d1ocoh_, d1ocoi_, d1ocoj_, d1ocok_, d1ocol_, d1ocom_, d1ocon_, d1ocoo1, d1ocoo2, d1ocop_, d1ocor_, d1ocos_, d1ocot_, d1ocou_, d1ocov_, d1ocow_, d1ocox_, d1ocoy_, d1ocoz_
   complexed with cmo, cu, hea, mg, na, zn

Details for d1ocoq_

PDB Entry: 1oco, 2.8 Å

PDB Description: bovine heart cytochrome c oxidase in carbon monoxide-bound state

PDB Compounds: (Q:) cytochrome c oxidase

SCOPe Domain Sequences for d1ocoq_:

Sequence; same for both SEQRES and ATOM records:

>d1ocoq_ f.23.1.1 (Q:) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

Timeline for d1ocoq_:

• d1ocoq_ first appeared (with stable ids) in SCOP 1.55, called d1ocoq1
  
• d1ocoq_ appears in SCOPe 2.05
  
• d1ocoq_ appears in SCOPe 2.07
  
• d1ocoq_ appears in the current release, SCOPe 2.08