| Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) |
| Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
Superfamily f.2.1: Membrane all-alpha [56869] (10 families) ![]() |
| Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins) |
| Protein Cytochrome c oxidase [56884] (3 species) |
| Species Cow (Bos taurus) [TaxId:9913] [56885] (5 PDB entries) |
| Domain d1ocop1: 1oco P: [43610] Other proteins in same PDB: d1ocob1, d1ocoe_, d1ocof_, d1ocoh_, d1ocoo1, d1ocor_, d1ocos_, d1ocou_ |
PDB Entry: 1oco (more details), 2.8 Å
SCOP Domain Sequences for d1ocop1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ocop1 f.2.1.3 (P:) Cytochrome c oxidase {Cow (Bos taurus)}
mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd
virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg
ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase
yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeagaw
ywhfvdvvwlflyvsiywwgs
Timeline for d1ocop1:
View in 3DDomains from other chains: (mouse over for more information) d1ocoa1, d1ocob1, d1ocob2, d1ococ1, d1ocod1, d1ocoe_, d1ocof_, d1ocog1, d1ocoh_, d1ocoi1, d1ocoj1, d1ocok1, d1ocol1, d1ocom1, d1ocon1, d1ocoo1, d1ocoo2, d1ocoq1, d1ocor_, d1ocos_, d1ocot1, d1ocou_, d1ocov1, d1ocow1, d1ocox1, d1ocoy1, d1ocoz1 |