Lineage for d1ocoo2 (1oco O:1-90)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519697Fold f.17: Transmembrane helix hairpin [81334] (2 superfamilies)
    two antiparallel transmembrane helices
  4. 519719Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) (S)
  5. 519720Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)
  6. 519737Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 519738Species Cow (Bos taurus) [TaxId:9913] [81454] (7 PDB entries)
  8. 519752Domain d1ocoo2: 1oco O:1-90 [43609]
    Other proteins in same PDB: d1ocoa_, d1ocob1, d1ococ_, d1ocod_, d1ocoe_, d1ocof_, d1ocog_, d1ocoh_, d1ocoi_, d1ocoj_, d1ocok_, d1ocol_, d1ocom_, d1ocon_, d1ocoo1, d1ocop_, d1ocoq_, d1ocor_, d1ocos_, d1ocot_, d1ocou_, d1ocov_, d1ocow_, d1ocox_, d1ocoy_, d1ocoz_

Details for d1ocoo2

PDB Entry: 1oco (more details), 2.8 Å

PDB Description: bovine heart cytochrome c oxidase in carbon monoxide-bound state

SCOP Domain Sequences for d1ocoo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocoo2 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus)}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOP Domain Coordinates for d1ocoo2:

Click to download the PDB-style file with coordinates for d1ocoo2.
(The format of our PDB-style files is described here.)

Timeline for d1ocoo2: