Lineage for d1ocol_ (1oco L:)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 340729Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
    not a true fold
  4. 340800Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family) (S)
  5. 340801Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (1 protein)
  6. 340802Protein Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81425] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 340803Species Cow (Bos taurus) [TaxId:9913] [81424] (5 PDB entries)
  8. 340812Domain d1ocol_: 1oco L: [43606]
    Other proteins in same PDB: d1ocoa_, d1ocob1, d1ocob2, d1ococ_, d1ocod_, d1ocoe_, d1ocof_, d1ocog_, d1ocoh_, d1ocoi_, d1ocoj_, d1ocok_, d1ocom_, d1ocon_, d1ocoo1, d1ocoo2, d1ocop_, d1ocoq_, d1ocor_, d1ocos_, d1ocot_, d1ocou_, d1ocov_, d1ocow_, d1ocox_, d1ocoz_

Details for d1ocol_

PDB Entry: 1oco (more details), 2.8 Å

PDB Description: bovine heart cytochrome c oxidase in carbon monoxide-bound state

SCOP Domain Sequences for d1ocol_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocol_ f.23.6.1 (L:) Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) {Cow (Bos taurus)}
shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk

SCOP Domain Coordinates for d1ocol_:

Click to download the PDB-style file with coordinates for d1ocol_.
(The format of our PDB-style files is described here.)

Timeline for d1ocol_: