Lineage for d1ocok_ (1oco K:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519895Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 519968Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
  5. 519969Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (1 protein)
  6. 519970Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 519971Species Cow (Bos taurus) [TaxId:9913] [81420] (7 PDB entries)
  8. 519984Domain d1ocok_: 1oco K: [43605]
    Other proteins in same PDB: d1ocoa_, d1ocob1, d1ocob2, d1ococ_, d1ocod_, d1ocoe_, d1ocof_, d1ocog_, d1ocoh_, d1ocoi_, d1ocoj_, d1ocol_, d1ocom_, d1ocon_, d1ocoo1, d1ocoo2, d1ocop_, d1ocoq_, d1ocor_, d1ocos_, d1ocot_, d1ocou_, d1ocov_, d1ocow_, d1ocoy_, d1ocoz_

Details for d1ocok_

PDB Entry: 1oco (more details), 2.8 Å

PDB Description: bovine heart cytochrome c oxidase in carbon monoxide-bound state
PDB Compounds: (K:)

SCOP Domain Sequences for d1ocok_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocok_ f.23.5.1 (K:) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus)}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOP Domain Coordinates for d1ocok_:

Click to download the PDB-style file with coordinates for d1ocok_.
(The format of our PDB-style files is described here.)

Timeline for d1ocok_: