| Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
| Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) ![]() |
| Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (1 protein) |
| Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
| Species Cow (Bos taurus) [TaxId:9913] [81403] (14 PDB entries) |
| Domain d1ocod_: 1oco D: [43601] Other proteins in same PDB: d1ocoa_, d1ocob1, d1ocob2, d1ococ_, d1ocoe_, d1ocof_, d1ocog_, d1ocoh_, d1ocoi_, d1ocoj_, d1ocok_, d1ocol_, d1ocom_, d1ocon_, d1ocoo1, d1ocoo2, d1ocop_, d1ocor_, d1ocos_, d1ocot_, d1ocou_, d1ocov_, d1ocow_, d1ocox_, d1ocoy_, d1ocoz_ |
PDB Entry: 1oco (more details), 2.8 Å
SCOP Domain Sequences for d1ocod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ocod_ f.23.1.1 (D:) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk
Timeline for d1ocod_:
View in 3DDomains from other chains: (mouse over for more information) d1ocoa_, d1ocob1, d1ocob2, d1ococ_, d1ocoe_, d1ocof_, d1ocog_, d1ocoh_, d1ocoi_, d1ocoj_, d1ocok_, d1ocol_, d1ocom_, d1ocon_, d1ocoo1, d1ocoo2, d1ocop_, d1ocoq_, d1ocor_, d1ocos_, d1ocot_, d1ocou_, d1ocov_, d1ocow_, d1ocox_, d1ocoy_, d1ocoz_ |