Class f: Membrane and cell surface proteins and peptides [56835] (49 folds) |
Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) |
Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81444] (7 PDB entries) |
Domain d1ococ_: 1oco C: [43600] Other proteins in same PDB: d1ocoa_, d1ocob1, d1ocob2, d1ocod_, d1ocoe_, d1ocof_, d1ocog_, d1ocoh_, d1ocoi_, d1ocoj_, d1ocok_, d1ocol_, d1ocom_, d1ocon_, d1ocoo1, d1ocoo2, d1ocoq_, d1ocor_, d1ocos_, d1ocot_, d1ocou_, d1ocov_, d1ocow_, d1ocox_, d1ocoy_, d1ocoz_ |
PDB Entry: 1oco (more details), 2.8 Å
SCOP Domain Sequences for d1ococ_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ococ_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus)} mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeagaw ywhfvdvvwlflyvsiywwgs
Timeline for d1ococ_:
View in 3D Domains from other chains: (mouse over for more information) d1ocoa_, d1ocob1, d1ocob2, d1ocod_, d1ocoe_, d1ocof_, d1ocog_, d1ocoh_, d1ocoi_, d1ocoj_, d1ocok_, d1ocol_, d1ocom_, d1ocon_, d1ocoo1, d1ocoo2, d1ocop_, d1ocoq_, d1ocor_, d1ocos_, d1ocot_, d1ocou_, d1ocov_, d1ocow_, d1ocox_, d1ocoy_, d1ocoz_ |