![]() | Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) |
![]() | Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
![]() | Superfamily f.2.1: Membrane all-alpha [56869] (10 families) ![]() |
![]() | Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins) |
![]() | Protein Cytochrome c oxidase [56884] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [56885] (5 PDB entries) |
![]() | Domain d1ococ1: 1oco C: [43600] Other proteins in same PDB: d1ocob1, d1ocoe_, d1ocof_, d1ocoh_, d1ocoo1, d1ocor_, d1ocos_, d1ocou_ |
PDB Entry: 1oco (more details), 2.8 Å
SCOP Domain Sequences for d1ococ1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ococ1 f.2.1.3 (C:) Cytochrome c oxidase {Cow (Bos taurus)} mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeagaw ywhfvdvvwlflyvsiywwgs
Timeline for d1ococ1:
![]() Domains from other chains: (mouse over for more information) d1ocoa1, d1ocob1, d1ocob2, d1ocod1, d1ocoe_, d1ocof_, d1ocog1, d1ocoh_, d1ocoi1, d1ocoj1, d1ocok1, d1ocol1, d1ocom1, d1ocon1, d1ocoo1, d1ocoo2, d1ocop1, d1ocoq1, d1ocor_, d1ocos_, d1ocot1, d1ocou_, d1ocov1, d1ocow1, d1ocox1, d1ocoy1, d1ocoz1 |