Lineage for d1ocob2 (1oco B:1-90)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237582Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
    two antiparallel transmembrane helices
  4. 1237604Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) (S)
  5. 1237605Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)
  6. 1237631Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 1237632Species Cow (Bos taurus) [TaxId:9913] [81454] (14 PDB entries)
  8. 1237659Domain d1ocob2: 1oco B:1-90 [43599]
    Other proteins in same PDB: d1ocoa_, d1ocob1, d1ococ_, d1ocod_, d1ocoe_, d1ocof_, d1ocog_, d1ocoh_, d1ocoi_, d1ocoj_, d1ocok_, d1ocol_, d1ocom_, d1ocon_, d1ocoo1, d1ocop_, d1ocoq_, d1ocor_, d1ocos_, d1ocot_, d1ocou_, d1ocov_, d1ocow_, d1ocox_, d1ocoy_, d1ocoz_
    complexed with cmo, cu, hea, mg, na, zn

Details for d1ocob2

PDB Entry: 1oco (more details), 2.8 Å

PDB Description: bovine heart cytochrome c oxidase in carbon monoxide-bound state
PDB Compounds: (B:) cytochrome c oxidase

SCOPe Domain Sequences for d1ocob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocob2 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d1ocob2:

Click to download the PDB-style file with coordinates for d1ocob2.
(The format of our PDB-style files is described here.)

Timeline for d1ocob2: