Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) |
Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81432] (7 PDB entries) |
Domain d1ocoa_: 1oco A: [43598] Other proteins in same PDB: d1ocob1, d1ocob2, d1ococ_, d1ocod_, d1ocoe_, d1ocof_, d1ocog_, d1ocoh_, d1ocoi_, d1ocoj_, d1ocok_, d1ocol_, d1ocom_, d1ocoo1, d1ocoo2, d1ocop_, d1ocoq_, d1ocor_, d1ocos_, d1ocot_, d1ocou_, d1ocov_, d1ocow_, d1ocox_, d1ocoy_, d1ocoz_ complexed with cmo, cu, hea, mg, na, zn |
PDB Entry: 1oco (more details), 2.8 Å
SCOPe Domain Sequences for d1ocoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ocoa_ f.24.1.1 (A:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]} mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr evltvdltttnlewlngcpppyhtfeeptyvnlk
Timeline for d1ocoa_:
View in 3D Domains from other chains: (mouse over for more information) d1ocob1, d1ocob2, d1ococ_, d1ocod_, d1ocoe_, d1ocof_, d1ocog_, d1ocoh_, d1ocoi_, d1ocoj_, d1ocok_, d1ocol_, d1ocom_, d1ocon_, d1ocoo1, d1ocoo2, d1ocop_, d1ocoq_, d1ocor_, d1ocos_, d1ocot_, d1ocou_, d1ocov_, d1ocow_, d1ocox_, d1ocoy_, d1ocoz_ |