Lineage for d1oczw_ (1ocz W:)

  1. Root: SCOP 1.67
  2. 425432Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)
  3. 426178Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 426233Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family) (S)
  5. 426234Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (1 protein)
  6. 426235Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 426236Species Cow (Bos taurus) [TaxId:9913] [81416] (7 PDB entries)
  8. 426248Domain d1oczw_: 1ocz W: [43594]
    Other proteins in same PDB: d1ocza_, d1oczb1, d1oczb2, d1oczc_, d1oczd_, d1ocze_, d1oczf_, d1oczg_, d1oczh_, d1oczi_, d1oczk_, d1oczl_, d1oczm_, d1oczn_, d1oczo1, d1oczo2, d1oczp_, d1oczq_, d1oczr_, d1oczs_, d1oczt_, d1oczu_, d1oczv_, d1oczx_, d1oczy_, d1oczz_
    complexed with azi, cu, hea, mg, na, zn

Details for d1oczw_

PDB Entry: 1ocz (more details), 2.9 Å

PDB Description: bovine heart cytochrome c oxidase in azide-bound state

SCOP Domain Sequences for d1oczw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oczw_ f.23.4.1 (W:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus)}
fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfp

SCOP Domain Coordinates for d1oczw_:

Click to download the PDB-style file with coordinates for d1oczw_.
(The format of our PDB-style files is described here.)

Timeline for d1oczw_: