SCOPe 2.04: Domain d1oczt_: 1ocz T:

Lineage for d1oczt_ (1ocz T:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family)
   automatically mapped to Pfam PF02046

5. Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
   probably responsible for the dimerization of the mitochondrial cytochrome c oxidase

7. Species Cow (Bos taurus) [TaxId:9913] [81408] (25 PDB entries)

8. Domain d1oczt_: 1ocz T: [43592]
   Other proteins in same PDB: d1ocza_, d1oczb1, d1oczb2, d1oczc_, d1oczd_, d1ocze_, d1oczf_, d1oczh_, d1oczi_, d1oczj_, d1oczk_, d1oczl_, d1oczm_, d1oczn_, d1oczo1, d1oczo2, d1oczp_, d1oczq_, d1oczr_, d1oczs_, d1oczu_, d1oczv_, d1oczw_, d1oczx_, d1oczy_, d1oczz_
   complexed with azi, cu, hea, mg, na, zn

Details for d1oczt_

PDB Entry: 1ocz, 2.9 Å

PDB Description: bovine heart cytochrome c oxidase in azide-bound state

PDB Compounds: (T:) cytochrome c oxidase

SCOPe Domain Sequences for d1oczt_:

Sequence; same for both SEQRES and ATOM records:

>d1oczt_ f.23.2.1 (T:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

Timeline for d1oczt_:

• d1oczt_ first appeared (with stable ids) in SCOP 1.55, called d1oczt1
  
• d1oczt_ appears in SCOPe 2.03
  
• d1oczt_ appears in SCOPe 2.05
  
• d1oczt_ appears in the current release, SCOPe 2.08