Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) |
Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81432] (7 PDB entries) |
Domain d1oczn_: 1ocz N: [43588] Other proteins in same PDB: d1oczb1, d1oczb2, d1oczc_, d1oczd_, d1ocze_, d1oczf_, d1oczg_, d1oczh_, d1oczi_, d1oczj_, d1oczk_, d1oczl_, d1oczm_, d1oczo1, d1oczo2, d1oczp_, d1oczq_, d1oczr_, d1oczs_, d1oczt_, d1oczu_, d1oczv_, d1oczw_, d1oczx_, d1oczy_, d1oczz_ complexed with azi, cu, hea, mg, na, zn |
PDB Entry: 1ocz (more details), 2.9 Å
SCOPe Domain Sequences for d1oczn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oczn_ f.24.1.1 (N:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]} mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr evltvdltttnlewlngcpppyhtfeeptyvnlk
Timeline for d1oczn_:
View in 3D Domains from other chains: (mouse over for more information) d1ocza_, d1oczb1, d1oczb2, d1oczc_, d1oczd_, d1ocze_, d1oczf_, d1oczg_, d1oczh_, d1oczi_, d1oczj_, d1oczk_, d1oczl_, d1oczm_, d1oczo1, d1oczo2, d1oczp_, d1oczq_, d1oczr_, d1oczs_, d1oczt_, d1oczu_, d1oczv_, d1oczw_, d1oczx_, d1oczy_, d1oczz_ |