Lineage for d1oczm_ (1ocz M:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456646Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1456963Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) (S)
    automatically mapped to Pfam PF02285
  5. 1456964Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins)
  6. 1456965Protein Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81429] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 1456966Species Cow (Bos taurus) [TaxId:9913] [81428] (8 PDB entries)
  8. 1456978Domain d1oczm_: 1ocz M: [43587]
    Other proteins in same PDB: d1ocza_, d1oczb1, d1oczb2, d1oczc_, d1oczd_, d1ocze_, d1oczf_, d1oczg_, d1oczh_, d1oczi_, d1oczj_, d1oczk_, d1oczl_, d1oczn_, d1oczo1, d1oczo2, d1oczp_, d1oczq_, d1oczr_, d1oczs_, d1oczt_, d1oczu_, d1oczv_, d1oczw_, d1oczx_, d1oczy_
    complexed with azi, cu, hea, mg, na, zn

Details for d1oczm_

PDB Entry: 1ocz (more details), 2.9 Å

PDB Description: bovine heart cytochrome c oxidase in azide-bound state
PDB Compounds: (M:) cytochrome c oxidase

SCOPe Domain Sequences for d1oczm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oczm_ f.23.7.1 (M:) Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

SCOPe Domain Coordinates for d1oczm_:

Click to download the PDB-style file with coordinates for d1oczm_.
(The format of our PDB-style files is described here.)

Timeline for d1oczm_: