Lineage for d1oczk_ (1ocz K:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 268041Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
    not a true fold
  4. 268098Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
  5. 268099Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (1 protein)
  6. 268100Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 268101Species Cow (Bos taurus) [TaxId:9913] [81420] (5 PDB entries)
  8. 268108Domain d1oczk_: 1ocz K: [43585]
    Other proteins in same PDB: d1ocza_, d1oczb1, d1oczb2, d1oczc_, d1oczd_, d1ocze_, d1oczf_, d1oczg_, d1oczh_, d1oczi_, d1oczj_, d1oczl_, d1oczm_, d1oczn_, d1oczo1, d1oczo2, d1oczp_, d1oczq_, d1oczr_, d1oczs_, d1oczt_, d1oczu_, d1oczv_, d1oczw_, d1oczy_, d1oczz_

Details for d1oczk_

PDB Entry: 1ocz (more details), 2.9 Å

PDB Description: bovine heart cytochrome c oxidase in azide-bound state

SCOP Domain Sequences for d1oczk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oczk_ f.23.5.1 (K:) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus)}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOP Domain Coordinates for d1oczk_:

Click to download the PDB-style file with coordinates for d1oczk_.
(The format of our PDB-style files is described here.)

Timeline for d1oczk_: