SCOP 1.67: Domain d1oczg_: 1ocz G:

Lineage for d1oczg_ (1ocz G:)

1. Root: SCOP 1.67

2. Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family)

5. Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
   probably responsible for the dimerization of the mitochondrial cytochrome c oxidase

7. Species Cow (Bos taurus) [TaxId:9913] [81408] (7 PDB entries)

8. Domain d1oczg_: 1ocz G: [43582]
   Other proteins in same PDB: d1ocza_, d1oczb1, d1oczb2, d1oczc_, d1oczd_, d1ocze_, d1oczf_, d1oczh_, d1oczi_, d1oczj_, d1oczk_, d1oczl_, d1oczm_, d1oczn_, d1oczo1, d1oczo2, d1oczp_, d1oczq_, d1oczr_, d1oczs_, d1oczu_, d1oczv_, d1oczw_, d1oczx_, d1oczy_, d1oczz_

Details for d1oczg_

PDB Entry: 1ocz, 2.9 Å

PDB Description: bovine heart cytochrome c oxidase in azide-bound state

SCOP Domain Sequences for d1oczg_:

Sequence; same for both SEQRES and ATOM records:

>d1oczg_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus)}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

Timeline for d1oczg_:

• d1oczg_ first appeared (with stable ids) in SCOP 1.55, called d1oczg1
  
• d1oczg_ appears in SCOP 1.65
  
• d1oczg_ appears in SCOP 1.69
  
• d1oczg_ appears in the current release, SCOPe 2.08