SCOP 1.67: Domain d1oczb2: 1ocz B:1-90

Lineage for d1oczb2 (1ocz B:1-90)

1. Root: SCOP 1.67

2. Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (2 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)

6. Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81454] (7 PDB entries)

8. Domain d1oczb2: 1ocz B:1-90 [43579]
   Other proteins in same PDB: d1ocza_, d1oczb1, d1oczc_, d1oczd_, d1ocze_, d1oczf_, d1oczg_, d1oczh_, d1oczi_, d1oczj_, d1oczk_, d1oczl_, d1oczm_, d1oczn_, d1oczo1, d1oczp_, d1oczq_, d1oczr_, d1oczs_, d1oczt_, d1oczu_, d1oczv_, d1oczw_, d1oczx_, d1oczy_, d1oczz_

Details for d1oczb2

PDB Entry: 1ocz, 2.9 Å

PDB Description: bovine heart cytochrome c oxidase in azide-bound state

SCOP Domain Sequences for d1oczb2:

Sequence; same for both SEQRES and ATOM records:

>d1oczb2 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus)}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

Timeline for d1oczb2:

• d1oczb2 first appeared (with stable ids) in SCOP 1.55
  
• d1oczb2 appears in SCOP 1.65
  
• d1oczb2 appears in SCOP 1.69
  
• d1oczb2 appears in the current release, SCOPe 2.08