Lineage for d1occz_ (1occ Z:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1059692Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) (S)
  5. 1059693Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins)
  6. 1059694Protein Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81429] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 1059695Species Cow (Bos taurus) [TaxId:9913] [81428] (7 PDB entries)
  8. 1059705Domain d1occz_: 1occ Z: [43577]
    Other proteins in same PDB: d1occa_, d1occb1, d1occb2, d1occc_, d1occd_, d1occe_, d1occf_, d1occg_, d1occh_, d1occi_, d1occj_, d1occk_, d1occl_, d1occn_, d1occo1, d1occo2, d1occp_, d1occq_, d1occr_, d1occs_, d1occt_, d1occu_, d1occv_, d1occw_, d1occx_, d1occy_
    complexed with cu, hea, mg, zn

Details for d1occz_

PDB Entry: 1occ (more details), 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state
PDB Compounds: (Z:) cytochrome c oxidase

SCOPe Domain Sequences for d1occz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1occz_ f.23.7.1 (Z:) Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

SCOPe Domain Coordinates for d1occz_:

Click to download the PDB-style file with coordinates for d1occz_.
(The format of our PDB-style files is described here.)

Timeline for d1occz_: