Lineage for d1occx_ (1occ X:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 268041Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
    not a true fold
  4. 268098Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
  5. 268099Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (1 protein)
  6. 268100Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 268101Species Cow (Bos taurus) [TaxId:9913] [81420] (5 PDB entries)
  8. 268107Domain d1occx_: 1occ X: [43575]
    Other proteins in same PDB: d1occa_, d1occb1, d1occb2, d1occc_, d1occd_, d1occe_, d1occf_, d1occg_, d1occh_, d1occi_, d1occj_, d1occl_, d1occm_, d1occn_, d1occo1, d1occo2, d1occp_, d1occq_, d1occr_, d1occs_, d1occt_, d1occu_, d1occv_, d1occw_, d1occy_, d1occz_
    complexed with cu, hea, mg, zn

Details for d1occx_

PDB Entry: 1occ (more details), 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d1occx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1occx_ f.23.5.1 (X:) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus)}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOP Domain Coordinates for d1occx_:

Click to download the PDB-style file with coordinates for d1occx_.
(The format of our PDB-style files is described here.)

Timeline for d1occx_: