![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
![]() | Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) ![]() |
![]() | Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins) |
![]() | Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species) probably responsible for the dimerization of the mitochondrial cytochrome c oxidase |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81408] (23 PDB entries) |
![]() | Domain d1occt_: 1occ T: [43572] Other proteins in same PDB: d1occa_, d1occb1, d1occb2, d1occc_, d1occd_, d1occe_, d1occf_, d1occh_, d1occi_, d1occj_, d1occk_, d1occl_, d1occm_, d1occn_, d1occo1, d1occo2, d1occp_, d1occq_, d1occr_, d1occs_, d1occu_, d1occv_, d1occw_, d1occx_, d1occy_, d1occz_ complexed with cu, hea, mg, zn |
PDB Entry: 1occ (more details), 2.8 Å
SCOPe Domain Sequences for d1occt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1occt_ f.23.2.1 (T:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]} asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf swgdgnhtffhnprvnplptgyek
Timeline for d1occt_:
![]() Domains from other chains: (mouse over for more information) d1occa_, d1occb1, d1occb2, d1occc_, d1occd_, d1occe_, d1occf_, d1occg_, d1occh_, d1occi_, d1occj_, d1occk_, d1occl_, d1occm_, d1occn_, d1occo1, d1occo2, d1occp_, d1occq_, d1occr_, d1occs_, d1occu_, d1occv_, d1occw_, d1occx_, d1occy_, d1occz_ |