Class f: Membrane and cell surface proteins and peptides [56835] (12 folds) |
Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
Superfamily f.2.1: Membrane all-alpha [56869] (11 families) |
Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins) |
Protein Cytochrome c oxidase [56884] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [56885] (5 PDB entries) |
Domain d1occt1: 1occ T: [43572] Other proteins in same PDB: d1occb1, d1occe_, d1occf_, d1occh_, d1occo1, d1occr_, d1occs_, d1occu_ |
PDB Entry: 1occ (more details), 2.8 Å
SCOP Domain Sequences for d1occt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1occt1 f.2.1.3 (T:) Cytochrome c oxidase {Cow (Bos taurus)} asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf swgdgnhtffhnprvnplptgyek
Timeline for d1occt1:
View in 3D Domains from other chains: (mouse over for more information) d1occa1, d1occb1, d1occb2, d1occc1, d1occd1, d1occe_, d1occf_, d1occg1, d1occh_, d1occi1, d1occj1, d1occk1, d1occl1, d1occm1, d1occn1, d1occo1, d1occo2, d1occp1, d1occq1, d1occr_, d1occs_, d1occu_, d1occv1, d1occw1, d1occx1, d1occy1, d1occz1 |