SCOP 1.73: Domain d1occq_: 1occ Q:

Lineage for d1occq_ (1occ Q:)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family)

5. Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81403] (14 PDB entries)

8. Domain d1occq_: 1occ Q: [43571]
   Other proteins in same PDB: d1occa_, d1occb1, d1occb2, d1occc_, d1occe_, d1occf_, d1occg_, d1occh_, d1occi_, d1occj_, d1occk_, d1occl_, d1occm_, d1occn_, d1occo1, d1occo2, d1occp_, d1occr_, d1occs_, d1occt_, d1occu_, d1occv_, d1occw_, d1occx_, d1occy_, d1occz_
   complexed with cu, hea, mg, zn

Details for d1occq_

PDB Entry: 1occ, 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state

PDB Compounds: (Q:) cytochrome c oxidase

SCOP Domain Sequences for d1occq_:

Sequence; same for both SEQRES and ATOM records:

>d1occq_ f.23.1.1 (Q:) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

Timeline for d1occq_:

• d1occq_ first appeared (with stable ids) in SCOP 1.55, called d1occq1
  
• d1occq_ appears in SCOP 1.71
  
• d1occq_ appears in SCOP 1.75
  
• d1occq_ appears in the current release, SCOPe 2.08