SCOPe 2.06: Domain d1occo2: 1occ O:1-90

Lineage for d1occo2 (1occ O:1-90)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81454] (35 PDB entries)

8. Domain d1occo2: 1occ O:1-90 [43569]
   Other proteins in same PDB: d1occa_, d1occb1, d1occc_, d1occd_, d1occe_, d1occf_, d1occg_, d1occh_, d1occi_, d1occj_, d1occk_, d1occl_, d1occm_, d1occn_, d1occo1, d1occp_, d1occq_, d1occr_, d1occs_, d1occt_, d1occu_, d1occv_, d1occw_, d1occx_, d1occy_, d1occz_
   complexed with cu, hea, mg, zn

Details for d1occo2

PDB Entry: 1occ, 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state

PDB Compounds: (O:) cytochrome c oxidase

SCOPe Domain Sequences for d1occo2:

Sequence; same for both SEQRES and ATOM records:

>d1occo2 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

Timeline for d1occo2:

• d1occo2 first appeared (with stable ids) in SCOP 1.55
  
• d1occo2 appears in SCOPe 2.05
  
• d1occo2 appears in SCOPe 2.07
  
• d1occo2 appears in the current release, SCOPe 2.08