Lineage for d1occl1 (1occ L:)

  1. Root: SCOP 1.57
  2. 87528Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 87593Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 87594Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 87754Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins)
  6. 87755Protein Cytochrome c oxidase [56884] (3 species)
  7. 87756Species Cow (Bos taurus) [TaxId:9913] [56885] (5 PDB entries)
  8. 87805Domain d1occl1: 1occ L: [43566]
    Other proteins in same PDB: d1occb1, d1occe_, d1occf_, d1occh_, d1occo1, d1occr_, d1occs_, d1occu_

Details for d1occl1

PDB Entry: 1occ (more details), 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d1occl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1occl1 f.2.1.3 (L:) Cytochrome c oxidase {Cow (Bos taurus)}
shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk

SCOP Domain Coordinates for d1occl1:

Click to download the PDB-style file with coordinates for d1occl1.
(The format of our PDB-style files is described here.)

Timeline for d1occl1: