SCOP 1.67: Domain d1occk_: 1occ K:

Lineage for d1occk_ (1occ K:)

1. Root: SCOP 1.67

2. Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family)

5. Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81420] (7 PDB entries)

8. Domain d1occk_: 1occ K: [43565]
   Other proteins in same PDB: d1occa_, d1occb1, d1occb2, d1occc_, d1occd_, d1occe_, d1occf_, d1occg_, d1occh_, d1occi_, d1occj_, d1occl_, d1occm_, d1occn_, d1occo1, d1occo2, d1occp_, d1occq_, d1occr_, d1occs_, d1occt_, d1occu_, d1occv_, d1occw_, d1occy_, d1occz_

Details for d1occk_

PDB Entry: 1occ, 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d1occk_:

Sequence; same for both SEQRES and ATOM records:

>d1occk_ f.23.5.1 (K:) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus)}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

Timeline for d1occk_:

• d1occk_ first appeared (with stable ids) in SCOP 1.55, called d1occk1
  
• d1occk_ appears in SCOP 1.65
  
• d1occk_ appears in SCOP 1.69
  
• d1occk_ appears in the current release, SCOPe 2.08