Lineage for d1occj_ (1occ J:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237971Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1238128Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family) (S)
  5. 1238129Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (1 protein)
  6. 1238130Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 1238131Species Cow (Bos taurus) [TaxId:9913] [81416] (23 PDB entries)
  8. 1238171Domain d1occj_: 1occ J: [43564]
    Other proteins in same PDB: d1occa_, d1occb1, d1occb2, d1occc_, d1occd_, d1occe_, d1occf_, d1occg_, d1occh_, d1occi_, d1occk_, d1occl_, d1occm_, d1occn_, d1occo1, d1occo2, d1occp_, d1occq_, d1occr_, d1occs_, d1occt_, d1occu_, d1occv_, d1occx_, d1occy_, d1occz_
    complexed with cu, hea, mg, zn

Details for d1occj_

PDB Entry: 1occ (more details), 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state
PDB Compounds: (J:) cytochrome c oxidase

SCOPe Domain Sequences for d1occj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1occj_ f.23.4.1 (J:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfp

SCOPe Domain Coordinates for d1occj_:

Click to download the PDB-style file with coordinates for d1occj_.
(The format of our PDB-style files is described here.)

Timeline for d1occj_: