Lineage for d1occi_ (1occ I:)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 620228Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 620265Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) (S)
  5. 620266Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein)
  6. 620267Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 620268Species Cow (Bos taurus) [TaxId:9913] [81412] (7 PDB entries)
  8. 620277Domain d1occi_: 1occ I: [43563]
    Other proteins in same PDB: d1occa_, d1occb1, d1occb2, d1occc_, d1occd_, d1occe_, d1occf_, d1occg_, d1occh_, d1occj_, d1occk_, d1occl_, d1occm_, d1occn_, d1occo1, d1occo2, d1occp_, d1occq_, d1occr_, d1occs_, d1occt_, d1occu_, d1occw_, d1occx_, d1occy_, d1occz_

Details for d1occi_

PDB Entry: 1occ (more details), 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d1occi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1occi_ f.23.3.1 (I:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus)}
stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
eemrkagifqsak

SCOP Domain Coordinates for d1occi_:

Click to download the PDB-style file with coordinates for d1occi_.
(The format of our PDB-style files is described here.)

Timeline for d1occi_: