SCOPe 2.08: Domain d1occg_: 1occ G:

Lineage for d1occg_ (1occ G:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family)
   automatically mapped to Pfam PF02046

5. Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
   probably responsible for the dimerization of the mitochondrial cytochrome c oxidase

7. Species Cow (Bos taurus) [TaxId:9913] [81408] (56 PDB entries)

8. Domain d1occg_: 1occ G: [43562]
   Other proteins in same PDB: d1occa_, d1occb1, d1occb2, d1occc_, d1occd_, d1occe_, d1occf_, d1occh_, d1occi_, d1occj_, d1occk_, d1occl_, d1occm_, d1occn_, d1occo1, d1occo2, d1occp_, d1occq_, d1occr_, d1occs_, d1occu_, d1occv_, d1occw_, d1occx_, d1occy_, d1occz_
   complexed with cu, hea, mg, zn

Details for d1occg_

PDB Entry: 1occ, 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state

PDB Compounds: (G:) cytochrome c oxidase

SCOPe Domain Sequences for d1occg_:

Sequence; same for both SEQRES and ATOM records:

>d1occg_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

Timeline for d1occg_:

• d1occg_ first appeared (with stable ids) in SCOP 1.55, called d1occg1
  
• d1occg_ appears in SCOPe 2.07