SCOP 1.67: Domain d1occd_: 1occ D:

Lineage for d1occd_ (1occ D:)

1. Root: SCOP 1.67

2. Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family)

5. Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81403] (7 PDB entries)

8. Domain d1occd_: 1occ D: [43561]
   Other proteins in same PDB: d1occa_, d1occb1, d1occb2, d1occc_, d1occe_, d1occf_, d1occg_, d1occh_, d1occi_, d1occj_, d1occk_, d1occl_, d1occm_, d1occn_, d1occo1, d1occo2, d1occp_, d1occr_, d1occs_, d1occt_, d1occu_, d1occv_, d1occw_, d1occx_, d1occy_, d1occz_

Details for d1occd_

PDB Entry: 1occ, 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d1occd_:

Sequence; same for both SEQRES and ATOM records:

>d1occd_ f.23.1.1 (D:) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus)}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

Timeline for d1occd_:

• d1occd_ first appeared (with stable ids) in SCOP 1.55, called d1occd1
  
• d1occd_ appears in SCOP 1.65
  
• d1occd_ appears in SCOP 1.69
  
• d1occd_ appears in the current release, SCOPe 2.08