Lineage for d1occb2 (1occ B:1-90)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237582Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
    two antiparallel transmembrane helices
  4. 1237604Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) (S)
  5. 1237605Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)
  6. 1237631Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 1237632Species Cow (Bos taurus) [TaxId:9913] [81454] (14 PDB entries)
  8. 1237655Domain d1occb2: 1occ B:1-90 [43559]
    Other proteins in same PDB: d1occa_, d1occb1, d1occc_, d1occd_, d1occe_, d1occf_, d1occg_, d1occh_, d1occi_, d1occj_, d1occk_, d1occl_, d1occm_, d1occn_, d1occo1, d1occp_, d1occq_, d1occr_, d1occs_, d1occt_, d1occu_, d1occv_, d1occw_, d1occx_, d1occy_, d1occz_
    complexed with cu, hea, mg, zn

Details for d1occb2

PDB Entry: 1occ (more details), 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state
PDB Compounds: (B:) cytochrome c oxidase

SCOPe Domain Sequences for d1occb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1occb2 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d1occb2:

Click to download the PDB-style file with coordinates for d1occb2.
(The format of our PDB-style files is described here.)

Timeline for d1occb2: