Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) automatically mapped to Pfam PF02046 |
Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins) |
Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species) probably responsible for the dimerization of the mitochondrial cytochrome c oxidase |
Species Cow (Bos taurus) [TaxId:9913] [81408] (36 PDB entries) |
Domain d1ocrt_: 1ocr T: [43552] Other proteins in same PDB: d1ocra_, d1ocrb1, d1ocrb2, d1ocrc_, d1ocrd_, d1ocre_, d1ocrf_, d1ocrh_, d1ocri_, d1ocrj_, d1ocrk_, d1ocrl_, d1ocrm_, d1ocrn_, d1ocro1, d1ocro2, d1ocrp_, d1ocrq_, d1ocrr_, d1ocrs_, d1ocru_, d1ocrv_, d1ocrw_, d1ocrx_, d1ocry_, d1ocrz_ complexed with cu, hea, mg, na, zn |
PDB Entry: 1ocr (more details), 2.35 Å
SCOPe Domain Sequences for d1ocrt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ocrt_ f.23.2.1 (T:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]} asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf swgdgnhtffhnprvnplptgyek
Timeline for d1ocrt_:
View in 3D Domains from other chains: (mouse over for more information) d1ocra_, d1ocrb1, d1ocrb2, d1ocrc_, d1ocrd_, d1ocre_, d1ocrf_, d1ocrg_, d1ocrh_, d1ocri_, d1ocrj_, d1ocrk_, d1ocrl_, d1ocrm_, d1ocrn_, d1ocro1, d1ocro2, d1ocrp_, d1ocrq_, d1ocrr_, d1ocrs_, d1ocru_, d1ocrv_, d1ocrw_, d1ocrx_, d1ocry_, d1ocrz_ |