Lineage for d1ocrq_ (1ocr Q:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456646Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1456647Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) (S)
    automatically mapped to Pfam PF02936
  5. 1456648Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins)
  6. 1456649Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 1456650Species Cow (Bos taurus) [TaxId:9913] [81403] (8 PDB entries)
  8. 1456659Domain d1ocrq_: 1ocr Q: [43551]
    Other proteins in same PDB: d1ocra_, d1ocrb1, d1ocrb2, d1ocrc_, d1ocre_, d1ocrf_, d1ocrg_, d1ocrh_, d1ocri_, d1ocrj_, d1ocrk_, d1ocrl_, d1ocrm_, d1ocrn_, d1ocro1, d1ocro2, d1ocrp_, d1ocrr_, d1ocrs_, d1ocrt_, d1ocru_, d1ocrv_, d1ocrw_, d1ocrx_, d1ocry_, d1ocrz_
    complexed with cu, hea, mg, na, zn

Details for d1ocrq_

PDB Entry: 1ocr (more details), 2.35 Å

PDB Description: bovine heart cytochrome c oxidase in the fully reduced state
PDB Compounds: (Q:) cytochrome c oxidase

SCOPe Domain Sequences for d1ocrq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocrq_ f.23.1.1 (Q:) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

SCOPe Domain Coordinates for d1ocrq_:

Click to download the PDB-style file with coordinates for d1ocrq_.
(The format of our PDB-style files is described here.)

Timeline for d1ocrq_: