SCOPe 2.06: Domain d1ocrm_: 1ocr M:

Lineage for d1ocrm_ (1ocr M:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family)
   automatically mapped to Pfam PF02285

5. Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81429] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81428] (19 PDB entries)

8. Domain d1ocrm_: 1ocr M: [43547]
   Other proteins in same PDB: d1ocra_, d1ocrb1, d1ocrb2, d1ocrc_, d1ocrd_, d1ocre_, d1ocrf_, d1ocrg_, d1ocrh_, d1ocri_, d1ocrj_, d1ocrk_, d1ocrl_, d1ocrn_, d1ocro1, d1ocro2, d1ocrp_, d1ocrq_, d1ocrr_, d1ocrs_, d1ocrt_, d1ocru_, d1ocrv_, d1ocrw_, d1ocrx_, d1ocry_
   complexed with cu, hea, mg, na, zn

Details for d1ocrm_

PDB Entry: 1ocr, 2.35 Å

PDB Description: bovine heart cytochrome c oxidase in the fully reduced state

PDB Compounds: (M:) cytochrome c oxidase

SCOPe Domain Sequences for d1ocrm_:

Sequence; same for both SEQRES and ATOM records:

>d1ocrm_ f.23.7.1 (M:) Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

Timeline for d1ocrm_:

• d1ocrm_ first appeared (with stable ids) in SCOP 1.55, called d1ocrm1
  
• d1ocrm_ appears in SCOPe 2.05
  
• d1ocrm_ appears in SCOPe 2.07
  
• d1ocrm_ appears in the current release, SCOPe 2.08