SCOP 1.67: Domain d1ocrl_: 1ocr L:

Lineage for d1ocrl_ (1ocr L:)

1. Root: SCOP 1.67

2. Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family)

5. Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81425] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81424] (7 PDB entries)

8. Domain d1ocrl_: 1ocr L: [43546]
   Other proteins in same PDB: d1ocra_, d1ocrb1, d1ocrb2, d1ocrc_, d1ocrd_, d1ocre_, d1ocrf_, d1ocrg_, d1ocrh_, d1ocri_, d1ocrj_, d1ocrk_, d1ocrm_, d1ocrn_, d1ocro1, d1ocro2, d1ocrp_, d1ocrq_, d1ocrr_, d1ocrs_, d1ocrt_, d1ocru_, d1ocrv_, d1ocrw_, d1ocrx_, d1ocrz_

Details for d1ocrl_

PDB Entry: 1ocr, 2.35 Å

PDB Description: bovine heart cytochrome c oxidase in the fully reduced state

SCOP Domain Sequences for d1ocrl_:

Sequence; same for both SEQRES and ATOM records:

>d1ocrl_ f.23.6.1 (L:) Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) {Cow (Bos taurus)}
shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk

Timeline for d1ocrl_:

• d1ocrl_ first appeared (with stable ids) in SCOP 1.55, called d1ocrl1
  
• d1ocrl_ appears in SCOP 1.65
  
• d1ocrl_ appears in SCOP 1.69
  
• d1ocrl_ appears in the current release, SCOPe 2.08