Lineage for d1ocrl1 (1ocr L:)

  1. Root: SCOP 1.59
  2. 141686Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 141752Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 141753Superfamily f.2.1: Membrane all-alpha [56869] (11 families) (S)
  5. 141921Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins)
  6. 141922Protein Cytochrome c oxidase [56884] (3 species)
  7. 141923Species Cow (Bos taurus) [TaxId:9913] [56885] (5 PDB entries)
  8. 141932Domain d1ocrl1: 1ocr L: [43546]
    Other proteins in same PDB: d1ocrb1, d1ocre_, d1ocrf_, d1ocrh_, d1ocro1, d1ocrr_, d1ocrs_, d1ocru_

Details for d1ocrl1

PDB Entry: 1ocr (more details), 2.35 Å

PDB Description: bovine heart cytochrome c oxidase in the fully reduced state

SCOP Domain Sequences for d1ocrl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocrl1 f.2.1.3 (L:) Cytochrome c oxidase {Cow (Bos taurus)}
shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk

SCOP Domain Coordinates for d1ocrl1:

Click to download the PDB-style file with coordinates for d1ocrl1.
(The format of our PDB-style files is described here.)

Timeline for d1ocrl1: