SCOPe 2.06: Domain d1ocrg_: 1ocr G:

Lineage for d1ocrg_ (1ocr G:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family)
   automatically mapped to Pfam PF02046

5. Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
   probably responsible for the dimerization of the mitochondrial cytochrome c oxidase

7. Species Cow (Bos taurus) [TaxId:9913] [81408] (36 PDB entries)

8. Domain d1ocrg_: 1ocr G: [43542]
   Other proteins in same PDB: d1ocra_, d1ocrb1, d1ocrb2, d1ocrc_, d1ocrd_, d1ocre_, d1ocrf_, d1ocrh_, d1ocri_, d1ocrj_, d1ocrk_, d1ocrl_, d1ocrm_, d1ocrn_, d1ocro1, d1ocro2, d1ocrp_, d1ocrq_, d1ocrr_, d1ocrs_, d1ocru_, d1ocrv_, d1ocrw_, d1ocrx_, d1ocry_, d1ocrz_
   complexed with cu, hea, mg, na, zn

Details for d1ocrg_

PDB Entry: 1ocr, 2.35 Å

PDB Description: bovine heart cytochrome c oxidase in the fully reduced state

PDB Compounds: (G:) cytochrome c oxidase

SCOPe Domain Sequences for d1ocrg_:

Sequence; same for both SEQRES and ATOM records:

>d1ocrg_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

Timeline for d1ocrg_:

• d1ocrg_ first appeared (with stable ids) in SCOP 1.55, called d1ocrg1
  
• d1ocrg_ appears in SCOPe 2.05
  
• d1ocrg_ appears in SCOPe 2.07
  
• d1ocrg_ appears in the current release, SCOPe 2.08