Lineage for d1ocrd_ (1ocr D:)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 340729Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
    not a true fold
  4. 340730Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) (S)
  5. 340731Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (1 protein)
  6. 340732Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 340733Species Cow (Bos taurus) [TaxId:9913] [81403] (5 PDB entries)
  8. 340734Domain d1ocrd_: 1ocr D: [43541]
    Other proteins in same PDB: d1ocra_, d1ocrb1, d1ocrb2, d1ocrc_, d1ocre_, d1ocrf_, d1ocrg_, d1ocrh_, d1ocri_, d1ocrj_, d1ocrk_, d1ocrl_, d1ocrm_, d1ocrn_, d1ocro1, d1ocro2, d1ocrp_, d1ocrr_, d1ocrs_, d1ocrt_, d1ocru_, d1ocrv_, d1ocrw_, d1ocrx_, d1ocry_, d1ocrz_

Details for d1ocrd_

PDB Entry: 1ocr (more details), 2.35 Å

PDB Description: bovine heart cytochrome c oxidase in the fully reduced state

SCOP Domain Sequences for d1ocrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocrd_ f.23.1.1 (D:) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus)}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

SCOP Domain Coordinates for d1ocrd_:

Click to download the PDB-style file with coordinates for d1ocrd_.
(The format of our PDB-style files is described here.)

Timeline for d1ocrd_: