![]() | Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) |
![]() | Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
![]() | Superfamily f.2.1: Membrane all-alpha [56869] (10 families) ![]() |
![]() | Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins) |
![]() | Protein Cytochrome c oxidase [56884] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [56885] (5 PDB entries) |
![]() | Domain d1ocrc1: 1ocr C: [43540] Other proteins in same PDB: d1ocrb1, d1ocre_, d1ocrf_, d1ocrh_, d1ocro1, d1ocrr_, d1ocrs_, d1ocru_ |
PDB Entry: 1ocr (more details), 2.35 Å
SCOP Domain Sequences for d1ocrc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ocrc1 f.2.1.3 (C:) Cytochrome c oxidase {Cow (Bos taurus)} mthqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrd virestfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptg ihplnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqase yyeapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeagaw ywhfvdvvwlflyvsiywwgs
Timeline for d1ocrc1:
![]() Domains from other chains: (mouse over for more information) d1ocra1, d1ocrb1, d1ocrb2, d1ocrd1, d1ocre_, d1ocrf_, d1ocrg1, d1ocrh_, d1ocri1, d1ocrj1, d1ocrk1, d1ocrl1, d1ocrm1, d1ocrn1, d1ocro1, d1ocro2, d1ocrp1, d1ocrq1, d1ocrr_, d1ocrs_, d1ocrt1, d1ocru_, d1ocrv1, d1ocrw1, d1ocrx1, d1ocry1, d1ocrz1 |