Lineage for d1ocrb2 (1ocr B:1-90)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456154Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
    two antiparallel transmembrane helices
  4. 1456176Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 1456177Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 1456219Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 1456220Species Cow (Bos taurus) [TaxId:9913] [81454] (24 PDB entries)
  8. 1456255Domain d1ocrb2: 1ocr B:1-90 [43539]
    Other proteins in same PDB: d1ocra_, d1ocrb1, d1ocrc_, d1ocrd_, d1ocre_, d1ocrf_, d1ocrg_, d1ocrh_, d1ocri_, d1ocrj_, d1ocrk_, d1ocrl_, d1ocrm_, d1ocrn_, d1ocro1, d1ocrp_, d1ocrq_, d1ocrr_, d1ocrs_, d1ocrt_, d1ocru_, d1ocrv_, d1ocrw_, d1ocrx_, d1ocry_, d1ocrz_
    complexed with cu, hea, mg, na, zn

Details for d1ocrb2

PDB Entry: 1ocr (more details), 2.35 Å

PDB Description: bovine heart cytochrome c oxidase in the fully reduced state
PDB Compounds: (B:) cytochrome c oxidase

SCOPe Domain Sequences for d1ocrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocrb2 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d1ocrb2:

Click to download the PDB-style file with coordinates for d1ocrb2.
(The format of our PDB-style files is described here.)

Timeline for d1ocrb2: