Lineage for d1ocra_ (1ocr A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632295Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 2632296Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 2632297Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 2632350Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species)
  7. 2632351Species Cow (Bos taurus) [TaxId:9913] [81432] (35 PDB entries)
  8. 2632384Domain d1ocra_: 1ocr A: [43538]
    Other proteins in same PDB: d1ocrb1, d1ocrb2, d1ocrc_, d1ocrd_, d1ocre_, d1ocrf_, d1ocrg_, d1ocrh_, d1ocri_, d1ocrj_, d1ocrk_, d1ocrl_, d1ocrm_, d1ocro1, d1ocro2, d1ocrp_, d1ocrq_, d1ocrr_, d1ocrs_, d1ocrt_, d1ocru_, d1ocrv_, d1ocrw_, d1ocrx_, d1ocry_, d1ocrz_
    complexed with cu, hea, mg, na, zn

Details for d1ocra_

PDB Entry: 1ocr (more details), 2.35 Å

PDB Description: bovine heart cytochrome c oxidase in the fully reduced state
PDB Compounds: (A:) cytochrome c oxidase

SCOPe Domain Sequences for d1ocra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocra_ f.24.1.1 (A:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]}
mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
evltvdltttnlewlngcpppyhtfeeptyvnlk

SCOPe Domain Coordinates for d1ocra_:

Click to download the PDB-style file with coordinates for d1ocra_.
(The format of our PDB-style files is described here.)

Timeline for d1ocra_: