SCOP 1.75: Domain d2occt_: 2occ T:

Lineage for d2occt_ (2occ T:)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family)

5. Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
   probably responsible for the dimerization of the mitochondrial cytochrome c oxidase

7. Species Cow (Bos taurus) [TaxId:9913] [81408] (14 PDB entries)

8. Domain d2occt_: 2occ T: [43532]
   Other proteins in same PDB: d2occa_, d2occb1, d2occb2, d2occc_, d2occd_, d2occe_, d2occf_, d2occh_, d2occi_, d2occj_, d2occk_, d2occl_, d2occm_, d2occn_, d2occo1, d2occo2, d2occp_, d2occq_, d2occr_, d2occs_, d2occu_, d2occv_, d2occw_, d2occx_, d2occy_, d2occz_
   complexed with cu, hea, mg, na, per, zn

Details for d2occt_

PDB Entry: 2occ, 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state

PDB Compounds: (T:) cytochrome c oxidase

SCOP Domain Sequences for d2occt_:

Sequence; same for both SEQRES and ATOM records:

>d2occt_ f.23.2.1 (T:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

Timeline for d2occt_:

• d2occt_ first appeared (with stable ids) in SCOP 1.55, called d2occt1
  
• d2occt_ appears in SCOP 1.73
  
• d2occt_ appears in SCOPe 2.01
  
• d2occt_ appears in the current release, SCOPe 2.08