SCOPe 2.06: Domain d2occq_: 2occ Q:

Lineage for d2occq_ (2occ Q:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family)
   automatically mapped to Pfam PF02936

5. Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81403] (19 PDB entries)

8. Domain d2occq_: 2occ Q: [43531]
   Other proteins in same PDB: d2occa_, d2occb1, d2occb2, d2occc_, d2occe_, d2occf_, d2occg_, d2occh_, d2occi_, d2occj_, d2occk_, d2occl_, d2occm_, d2occn_, d2occo1, d2occo2, d2occp_, d2occr_, d2occs_, d2occt_, d2occu_, d2occv_, d2occw_, d2occx_, d2occy_, d2occz_
   complexed with cu, hea, mg, na, per, zn

Details for d2occq_

PDB Entry: 2occ, 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state

PDB Compounds: (Q:) cytochrome c oxidase

SCOPe Domain Sequences for d2occq_:

Sequence; same for both SEQRES and ATOM records:

>d2occq_ f.23.1.1 (Q:) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

Timeline for d2occq_:

• d2occq_ first appeared (with stable ids) in SCOP 1.55, called d2occq1
  
• d2occq_ appears in SCOPe 2.05
  
• d2occq_ appears in SCOPe 2.07
  
• d2occq_ appears in the current release, SCOPe 2.08