Lineage for d2occq_ (2occ Q:)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 620228Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 620229Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) (S)
  5. 620230Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (1 protein)
  6. 620231Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 620232Species Cow (Bos taurus) [TaxId:9913] [81403] (7 PDB entries)
  8. 620240Domain d2occq_: 2occ Q: [43531]
    Other proteins in same PDB: d2occa_, d2occb1, d2occb2, d2occc_, d2occe_, d2occf_, d2occg_, d2occh_, d2occi_, d2occj_, d2occk_, d2occl_, d2occm_, d2occn_, d2occo1, d2occo2, d2occp_, d2occr_, d2occs_, d2occt_, d2occu_, d2occv_, d2occw_, d2occx_, d2occy_, d2occz_
    complexed with cu, hea, mg, na, per, zn

Details for d2occq_

PDB Entry: 2occ (more details), 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d2occq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2occq_ f.23.1.1 (Q:) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus)}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

SCOP Domain Coordinates for d2occq_:

Click to download the PDB-style file with coordinates for d2occq_.
(The format of our PDB-style files is described here.)

Timeline for d2occq_: