Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) |
Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
Superfamily f.2.1: Membrane all-alpha [56869] (10 families) |
Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins) |
Protein Cytochrome c oxidase [56884] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [56885] (5 PDB entries) |
Domain d2occo2: 2occ O:1-90 [43529] Other proteins in same PDB: d2occb1, d2occe_, d2occf_, d2occh_, d2occo1, d2occr_, d2occs_, d2occu_ |
PDB Entry: 2occ (more details), 2.3 Å
SCOP Domain Sequences for d2occo2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2occo2 f.2.1.3 (O:1-90) Cytochrome c oxidase {Cow (Bos taurus)} maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe vetiwtilpaiililialpslrilymmdei
Timeline for d2occo2:
View in 3D Domains from other chains: (mouse over for more information) d2occa1, d2occb1, d2occb2, d2occc1, d2occd1, d2occe_, d2occf_, d2occg1, d2occh_, d2occi1, d2occj1, d2occk1, d2occl1, d2occm1, d2occn1, d2occp1, d2occq1, d2occr_, d2occs_, d2occt1, d2occu_, d2occv1, d2occw1, d2occx1, d2occy1, d2occz1 |