SCOP 1.69: Domain d2occm_: 2occ M:

Lineage for d2occm_ (2occ M:)

1. Root: SCOP 1.69

2. Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family)

5. Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81429] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81428] (7 PDB entries)

8. Domain d2occm_: 2occ M: [43527]
   Other proteins in same PDB: d2occa_, d2occb1, d2occb2, d2occc_, d2occd_, d2occe_, d2occf_, d2occg_, d2occh_, d2occi_, d2occj_, d2occk_, d2occl_, d2occn_, d2occo1, d2occo2, d2occp_, d2occq_, d2occr_, d2occs_, d2occt_, d2occu_, d2occv_, d2occw_, d2occx_, d2occy_

Details for d2occm_

PDB Entry: 2occ, 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d2occm_:

Sequence; same for both SEQRES and ATOM records:

>d2occm_ f.23.7.1 (M:) Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) {Cow (Bos taurus)}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

Timeline for d2occm_:

• d2occm_ first appeared (with stable ids) in SCOP 1.55, called d2occm1
  
• d2occm_ appears in SCOP 1.67
  
• d2occm_ appears in SCOP 1.71
  
• d2occm_ appears in the current release, SCOPe 2.08