![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) ![]() automatically mapped to Pfam PF05392 |
![]() | Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins) |
![]() | Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81420] (19 PDB entries) |
![]() | Domain d2occk_: 2occ K: [43525] Other proteins in same PDB: d2occa_, d2occb1, d2occb2, d2occc_, d2occd_, d2occe_, d2occf_, d2occg_, d2occh_, d2occi_, d2occj_, d2occl_, d2occm_, d2occn_, d2occo1, d2occo2, d2occp_, d2occq_, d2occr_, d2occs_, d2occt_, d2occu_, d2occv_, d2occw_, d2occy_, d2occz_ complexed with cu, hea, mg, na, per, zn |
PDB Entry: 2occ (more details), 2.3 Å
SCOPe Domain Sequences for d2occk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2occk_ f.23.5.1 (K:) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus) [TaxId: 9913]} apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
Timeline for d2occk_:
![]() Domains from other chains: (mouse over for more information) d2occa_, d2occb1, d2occb2, d2occc_, d2occd_, d2occe_, d2occf_, d2occg_, d2occh_, d2occi_, d2occj_, d2occl_, d2occm_, d2occn_, d2occo1, d2occo2, d2occp_, d2occq_, d2occr_, d2occs_, d2occt_, d2occu_, d2occv_, d2occw_, d2occx_, d2occy_, d2occz_ |